Full name: RNA pseudouridylate synthase domain-containing protein 4
Synonym:
GI: None
Orf:
COG:
UniProt:
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification: l:1397(None) - Y

Comments:



Protein sequence:

MAAPRWSASGPWIRGNGQGCGSLFTLVSKPFCAAAAASTAINAQRLAEKLRAQKREQDTK KEPVSTNAVQRRVQEIVRFTRQLQRVHPNVLAKALTRGILHQDKNLVVINKPYGLPVHGG PGVQLCITDVLPILAKMLHGHKAEPLHLCHRLDKETTGVMVLAWDKDMAHQVQELFRTRQ VVKKYWAITVHVPMPSAGVVDIPIVEKEAQGQQQHHKMTLSPSYRMDDGKMVKVRRSRNA QVAVTQYQVLSSTLSSALVELQPITGIKHQLRVHLSFGLDCPILGDHKYSDWNRLAPQKL SVGTLKKLGLEQSKARYIPLHLHARQLILPALGSGKEELNLVCKLPRFFVHSLHRLRLEM PNEDQNENNEAKCLGAQ

Publications:

Title Authors Journal Details PubMed Id DOI
The Pseudouridine Synthase RPUSD4 Is an Essential Component of Mitochondrial RNA Granules. Zaganelli S, Rebelo-Guiomar P, Maundrell K, Rozanska A, Pierredon S, Powell CA, Jourdain AA, Hulo N, Lightowlers RN, Chrzanowska-Lightowlers ZM, Minczuk M, Martinou JC J Biol Chem [details] 28082677 10.1074/jbc.M116.771105
A pseudouridine synthase module is essential for mitochondrial protein synthesis and cell viability. Antonicka H, Choquet K, Lin ZY, Gingras AC, Kleinman CL, Shoubridge EA EMBO Rep. [details] 27974379 10.15252/embr.201643391
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto