Full name: Queuine tRNA-ribosyltransferase catalytic subunit 1
Synonym: QTRT1, TGUT
GI: 221218971
Orf:
COG:
UniProt:
Structures: | |
Complex:
Enzyme type:
Position of modification - modification:

Comments:

tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code for asparagine, aspartic acid, histidine and tyrosine.

Protein sequence:

MAGAATQASLESAPRIMRLVAECSRSRARAGELWLPHGTVATPVFMPVGTQATMKGITTE QLDALGCRICLGNTYHLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVSLVSLSEV TEEGVRFRSPYDGNETLLSPEKSVQIQNALGSDIIMQLDDVVSSTVTGPRVEEAMYRSIR WLDRCIAAHQRPDKQNLFAIIQGGLDADLRATCLEEMTKRDVPGFAIGGLSGGESKSQFW RMVALSTSRLPKDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQ LRKKVFEKDFGPIDPECTCPTCQKHSRAFLHALLHSDNTAALHHLTVHNIAYQLQLMSAV RTSIVEKRFPDFVRDFMGAMYGDPTLCPTWATDALASVGITLG

Publications:

Title Authors Journal Details PubMed Id DOI
Characterization of the human tRNA-guanine transglycosylase: confirmation of the heterodimeric subunit structure. Chen YC, Kelly VP, Stachura SV, Garcia GA RNS [details] 20354154 10.1261/rna.1997610
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto