Full name: DR_0049
Synonym:
GI: None
Orf:
COG:
UniProt:
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

DR_0049 encodes the methyltransferase producing m5C2499 in D. radiodurans 23S rRNA. Growth experiments disclosed that inactivation of DR_0049 is associated with a severe growth defect.

Protein sequence:

MSAPASSAPRLRLRVSKAAELHIRDGHPWVYESSVREQNREGEPGELAVVYDRRDRFLAI GLYDPFSPLRLRVLHTGMPTQLDDAWWAARLDAALARRAALFGPLTAFGDTDGYRVLNGE SDGFPGLVVDRYAGVLVMKLYTAAWFPHLRRMLELFAARAPDFAVVLRLSRNIAERAADL GLHDGQVIYGELAGDSVVFRESGLRFEAEVRQGQKTGFFLDQRENRRRVEGLSEGRRVLN AFSFSGGFSLYAARGGASEVTSLDISAHALRSAERNFALNPELSAVHKTVQADVFEWLPA GKGSGADYDLVILDPPSLARREAEREGAIRAYGKLAEGGLTRLAPGGILVSASCSAHVSA EEFEEAVMSAVRRSGRRWRKLLSSRHAPDHHASFAEAEYLKAVFLQMD

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of the methyltransferase targeting C2499 in Deinococcus radiodurans 23S ribosomal RNA. Mundus J, Flyvbjerg KF, Kirpekar F Extremophiles [details] 26590840 10.1007/s00792-015-0800-z
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto