Full name: tRNA (adenine(9)-N1)-methyltransferase
Synonym:
GI: None
Orf:
COG:
UniProt:
Structures: | 5A7T | 5A7Y | 5A7Z |
Complex:
Enzyme type: methyltransferase
Position of modification - modification:

Comments:



Protein sequence:

MTLAKVFSQKLRELGISSIYIGHERPSLQSLAIKMLLKNYGLVEERREGMLITQDHGIKL ISGKGTETSRYTFRKGGKKVSIHLPEYPKMVIDLGLFEFLNEEEKEKTLLQVDLCLSVIR KFLWDGNLTVVGKADYVLGRANIVQSLSLSDEDNPVILDPYGDVVATDQILRDHNVFVIG GIVDKGRRLDRATERLALSRGYSFPRVKIQLRGSIIGVPDEINKILEIILRVKELDQSLE EAIISLQSKSDKISRLLHDVQLYGMEVLEEEARWLRADDKVIEIVRSRLGKN

Publications:

Title Authors Journal Details PubMed Id DOI
Structural and functional insights into tRNA binding and adenosine N1-methylation by an archaeal Trm10 homologue. Van Laer B, Roovers M, Wauters L, Kasprzak JM, Dyzma M, Deyaert E, Kumar Singh R, Feller A, Bujnicki JM, Droogmans L, Versées W Nucleic Acids Res. [details] 26673726 10.1093/nar/gkv1369
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto