Modomics - A Database of RNA Modifications

ID Card:

Full name: 23S rRNA (Uracil-C(5))-methyltransferase RlmCD
GI: 2034612541
Orf: SpnNT_01953
Enzyme type: methyltransferase



Protein sequence:

MHLHYDKQLEFKTDLLHQALKKFAPAGYENYEIRPTIGMQEPKYYRAKLQFQTRKFKNQVKAGLYAQNSHYLVELKDCLVQDKETQVIANRLAELLTYHQIPITDERKVLGVRTIMVRRARKTGQVQIIIVTNRQLNLTQLVKELVKDFPEVVTVAVNTNTAKTSEIYGEKTEIIWGQESIQEGVLNYEFSLSPRAFYQLNPEQTEVLYSEAVKALDVDKEDHLIDAYCGVGTIGFAFAKKVKTLRGMDIIPEAIEDAKRNAKRMGFDNTHYEAGTAEEIIPRWYKEGYRADALIVDPPRTGLDDKLLDTILTYVPEKMVYISCNVSTLARDLVRLVEVYDLHYIQSVDMFPHTARTEAVVKLIKKV

Comments:

RlmCD encoded by SP_1029 in S. pneumoniae is responsible for C5-methylation of U747 and U1939. Methylation of 23S rRNA by the dual-specific methyltransferase, RlmCD, guides the 23S rRNA efficiently to sequential methylation by the other methyltransferase, RlmAII, rendering S. pneumoniae TEL susceptible.







Publications:

Title Authors Journal Details PubMed Id DOI
RlmCD-mediated U747 methylation promotes efficient G748 methylation by methyltransferase RlmAII in 23S rRNA in Streptococcus pneumoniae; interplay between two rRNA methylations responsible for telithr Shoji T, Takaya A, Sato Y, Kimura S, Suzuki T, Yamamoto T Nucleic Acids Res [details] 26365244 10.1093/nar/gkv609