Modomics - A Database of RNA Modifications

ID Card:

Full name:	23S rRNA (Uracil-C(5))-methyltransferase RlmCD
GI:	2034612541
Orf:	SpnNT_01953
Enzyme type:	methyltransferase

Protein sequence:

MHLHYDKQLEFKTDLLHQALKKFAPAGYENYEIRPTIGMQEPKYYRAKLQFQTRKFKNQVKAGLYAQNSHYLVELKDCLVQDKETQVIANRLAELLTYHQIPITDERKVLGVRTIMVRRARKTGQVQIIIVTNRQLNLTQLVKELVKDFPEVVTVAVNTNTAKTSEIYGEKTEIIWGQESIQEGVLNYEFSLSPRAFYQLNPEQTEVLYSEAVKALDVDKEDHLIDAYCGVGTIGFAFAKKVKTLRGMDIIPEAIEDAKRNAKRMGFDNTHYEAGTAEEIIPRWYKEGYRADALIVDPPRTGLDDKLLDTILTYVPEKMVYISCNVSTLARDLVRLVEVYDLHYIQSVDMFPHTARTEAVVKLIKKV

Comments:

RlmCD encoded by SP_1029 in S. pneumoniae is responsible for C5-methylation of U747 and U1939. Methylation of 23S rRNA by the dual-specific methyltransferase, RlmCD, guides the 23S rRNA efficiently to sequential methylation by the other methyltransferase, RlmAII, rendering S. pneumoniae TEL susceptible.

Publications:

Search:

Title	Authors	Journal	Details	PubMed Id	DOI
RlmCD-mediated U747 methylation promotes efficient G748 methylation by methyltransferase RlmAII in 23S rRNA in Streptococcus pneumoniae; interplay between two rRNA methylations responsible for telithr	Shoji T, Takaya A, Sato Y, Kimura S, Suzuki T, Yamamoto T	Nucleic Acids Res	[details]	26365244	10.1093/nar/gkv609


RlmCD-mediated U747 methylation promotes efficient G748 methylation by methyltransferase RlmAII in 23S rRNA in Streptococcus pneumoniae; interplay between two rRNA methylations responsible for telithr

Showing 1 to 1 of 1 entries