Full name: queuine tRNA-ribosyltransferase accessory subunit 2
Synonym: FLJ12960
GI: None
Orf:
COG:
UniProt:
Structures: | Q9H974 |
Complex:
Enzyme type: transglycosylase
Position of modification - modification:

Comments:



Protein sequence:

>sp|Q9H974|QTRT2_HUMAN Queuine tRNA-ribosyltransferase accessory subunit 2 OS=Homo sapiens OX=9606 GN=QTRT2 PE=1 SV=1 MKLSLTKVVNGCRLGKIKNLGKTGDHTMDIPGCLLYTKTGSAPHLTHHTLHNIHGVPAMA QLTLSSLAEHHEVLTEYKEGVGKFIGMPESLLYCSLHDPVSPCPAGYVTNKSVSVWSVAG RVEMTVSKFMAIQKALQPDWFQCLSDGEVSCKEATSIKRVRKSVDRSLLFLDNCLRLQEE SEVLQKSVIIGVIEGGDVMEERLRSARETAKRPVGGFLLDGFQGNPTTLEARLRLLSSVT AELPEDKPRLISGVSRPDEVLECIERGVDLFESFFPYQVTERGCALTFSFDYQPNPEETL LQQNGTQEEIKCMDQIKKIETTGCNQEITSFEINLKEKKYQEDFNPLVRGCSCYCCKNHT RAYIHHLLVTNELLAGVLLMMHNFEHYFGFFHYIREALKSDKLAQLKELIHRQAS
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto