Modomics - A Database of RNA Modifications

Full name: elongator acetyltransferase complex subunit 3
Synonym: FLJ10422 KAT9
GI: None
Orf:
COG:
UniProt:
Structures: | Q9H9T3 |
Complex:
Enzyme type: acetyltransferase
Position of modification - modification:

Comments:



Protein sequence:

>sp|Q9H9T3|ELP3_HUMANElongatorcomplexprotein3OS=HomosapiensOX=9606GN=ELP3PE=1SV=2MRQKRKGDLSPAELMMLTI
GDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSD
FEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGIT
IETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQFTEFFENPAFRPDGLKLYP
TLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQ
VELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIA
VISGVGTRNYYRKIGYRLQGPYMVKMLK

Publications:

Title Authors Journal Details PubMed Id DOI
Purification and characterization of the human elongator complex. Hawkes NA, Otero G, Winkler GS, Marshall N, Dahmus ME, Krappmann D, Scheidereit C, Thomas CL, Schiavo G, Erdjument-Bromage H, Tempst P, Svejstrup JQ... J Biol Chem [details] 11714725 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca