Full name: cytosolic thiouridylase subunit 1
Synonym: MGC17332, NCS6
GI: None
Orf:
COG:
UniProt:
Structures: | Q7Z7A3 |
Complex:
Enzyme type: thiolase
Position of modification - modification:

Comments:



Protein sequence:

>sp|Q7Z7A3|CTU1_HUMAN Cytoplasmic tRNA 2-thiolation protein 1 OS=Homo sapiens OX=9606 GN=CTU1 PE=1 SV=1 MPAPPCASCHAARAALRRPLSGQALCGACFCAAFEAEVLHTVLAGRLLPPGAVVAVGASG GKDSTVLAHVLRALAPRLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYED LFGGWTMDAVARSTAGSGRSRSCCTFCGVLRRRALEEGARRVGATHIVTGHNADDMAETV LMNFLRGDAGRLARGGGLGSPGEGGALPRCRPLQFASQKEVVLYAHFRRLDYFSEECVYA PEAFRGHARDLLKRLEAARPSAVLDLVHSAERLALAPAARPPRPGACSRCGALASRALCQ ACALLDGLNRGRPRLAIGKGRRGLDEEATPGTPGDPARPPASKAVPTF

Publications:

Title Authors Journal Details PubMed Id DOI
A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. Schlieker CD, Van der Veen AG, Damon JR, Spooner E, Ploegh HL... Proc Natl Acad Sci U S A [details] 19017811 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto