Full name: tRNA-histidine guanylyltransferase 1 like
Synonym: ICF45 FLJ11601 FLJ20546 IHG-1 hTHG1
GI: None
Orf:
COG:
UniProt:
Structures: | Q9NWX6 |
Complex:
Enzyme type: guanylyltransferase
Position of modification - modification:

Comments:



Protein sequence:

>sp|Q9NWX6|THG1_HUMAN Probable tRNA(His) guanylyltransferase OS=Homo sapiens OX=9606 GN=THG1L PE=1 SV=2 MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGR NFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKR RASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADC HINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNELPMYRKGTV LIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS

Publications:

Title Authors Journal Details PubMed Id DOI
tRNAHis guanylyltransferase (THG1), a unique 3′-5′ nucleotidyl transferase, shares unexpected structural homology with canonical 5′-3′ DNA polymerases. Hyde SJ, Eckenroth BE, Smith BA, Eberley WA, Heintz NH, Jackman JE, Doublié S Proc Natl Acad Sci U S A [details] 21059936 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto