Full name: methyltransferase like 6
Synonym: MGC24132
GI: None
Orf:
COG:
UniProt:
Structures: | Q8TCB7 |
Complex:
Enzyme type: methylthiotransferase
Position of modification - modification:

Comments:



Protein sequence:

>sp|Q8TCB7|METL6_HUMAN Methyltransferase-like protein 6 OS=Homo sapiens OX=9606 GN=METTL6 PE=2 SV=2 MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDR HWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVK QNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLK PGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVV NEYVFRETVNKKEGLCVPRVFLQSKFLKPPKNPSPVVLGLDPKS

Publications:

Title Authors Journal Details PubMed Id DOI
A tRNA methyltransferase paralog is important for ribosome stability and cell division in Trypanosoma brucei. Fleming IM, Paris Z, Gaston KW, Balakrishnan R, Fredrick K, Rubio MA, Alfonzo JD... Sci Rep [details] 26888608 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto