Modomics - A Database of RNA Modifications

Full name: ubiquitin related modifier 1
Synonym: MGC2668
GI: None
Orf:
COG:
UniProt:
Structures: | Q9BTM9 |
Complex:
Enzyme type:
Position of modification - modification:

Comments:



Protein sequence:

>sp|Q9BTM9|URM1_HUMANUbiquitin-relatedmodifier1OS=HomosapiensOX=9606GN=URM1PE=1SV=1MAAPLSVEVEFGGGAEL
LFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG

Publications:

Title Authors Journal Details PubMed Id DOI
Solution structure of Urm1 and its implications for the origin of protein modifiers. Xu J, Zhang J, Wang L, Zhou J, Huang H, Wu J, Zhong Y, Shi Y... Proc Natl Acad Sci U S A [details] 16864801 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca