Full name: ubiquitin related modifier 1
Synonym: MGC2668
GI: None
Orf:
COG:
UniProt:
Structures: | Q9BTM9 |
Complex:
Enzyme type:
Position of modification - modification:

Comments:



Protein sequence:

>sp|Q9BTM9|URM1_HUMAN Ubiquitin-related modifier 1 OS=Homo sapiens OX=9606 GN=URM1 PE=1 SV=1 MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQG DSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG

Publications:

Title Authors Journal Details PubMed Id DOI
Solution structure of Urm1 and its implications for the origin of protein modifiers. Xu J, Zhang J, Wang L, Zhou J, Huang H, Wu J, Zhong Y, Shi Y... Proc Natl Acad Sci U S A [details] 16864801 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto