Full name: molybdenum cofactor synthesis 3
Synonym: UBA4, dJ914P20.3
GI: None
Orf:
COG:
UniProt:
Structures: | O95396 |
Complex:
Enzyme type: adenylyltransferase, sulfurtransferase
Position of modification - modification:

Comments:



Protein sequence:

>sp|O95396|MOCS3_HUMAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Homo sapiens OX=9606 GN=MOCS3 PE=1 SV=1 MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEI LRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMS NLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCS DNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCA DGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAAC GERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQV EVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQK AVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY

Publications:

Title Authors Journal Details PubMed Id DOI
Molybdenum cofactor biosynthesis in humans: identification of a persulfide group in the rhodanese-like domain of MOCS3 by mass spectrometry. Matthies A, Nimtz M, Leimkuhler S... Biochemistry [details] 15910006 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto