Full name: NFS1, cysteine desulfurase
Synonym: NifS, IscS
GI: None
Orf:
COG:
UniProt:
Structures: | Q9Y697 |
Complex:
Enzyme type: desulfurase
Position of modification - modification:

Comments:



Protein sequence:

>sp|Q9Y697|NFS1_HUMAN Cysteine desulfurase, mitochondrial OS=Homo sapiens OX=9606 GN=NFS1 PE=1 SV=3 MLLRAAWRRAAVAVTAAPGPKPAAPTRGLRLRVGDRAPQSAVPADTAAAPEVGPVLRPLY MDVQATTPLDPRVLDAMLPYLINYYGNPHSRTHAYGWESEAAMERARQQVASLIGADPRE IIFTSGATESNNIAIKGVARFYRSRKKHLITTQTEHKCVLDSCRSLEAEGFQVTYLPVQK SGIIDLKELEAAIQPDTSLVSVMTVNNEIGVKQPIAEIGRICSSRKVYFHTDAAQAVGKI PLDVNDMKIDLMSISGHKIYGPKGVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPL VVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSFAY VEGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTEEEVD YTVEKCIQHVKRLREMSPLWEMVQDGIDLKSIKWTQH

Publications:

Title Authors Journal Details PubMed Id DOI
Role of human mitochondrial Nfs1 in cytosolic iron-sulfur protein biogenesis and iron regulation. Biederbick A, Stehling O, Rosser R, Niggemeyer B, Nakai Y, Elsasser HP, Lill R... Mol Cell Biol [details] 16847322 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto