Full name: iron-sulfur cluster assembly enzyme
Synonym: ISU2, hnifU, IscU
GI: None
Orf:
COG:
UniProt:
Structures: | Q9H1K1 |
Complex:

Comments:



Protein sequence:

>sp|Q9H1K1|ISCU_HUMANIron-sulfurclusterassemblyenzymeISCU,mitochondrialOS=HomosapiensOX=9606GN=ISCUP
E=1SV=2MAAAGAFRLRRAASALLLRSPRLPARELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTF
GCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Publications:

Title Authors Journal Details PubMed Id DOI
Distinct iron-sulfur cluster assembly complexes exist in the cytosol and mitochondria of human cells. Tong WH, Rouault T... EMBO J [details] 11060020 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca