Full name: tRNA 2-selenouridine(34) synthase
Synonym: SelU, YbbB
GI: 2506609
Orf: ybbB, b0503
COG: COG2603
UniProt: P33667
Structures: | |
Complex:
Enzyme type: selenotransferase/geranyltransferase
Position of modification - modification: t:34 - cmnm5ges2U
t:34 - mnm5se2U
t:34 - mnm5ges2U

Comments:

catalyzes conversion: (x5)s2U(x5)se2U. May require SelD? ATP/GTP binding protein. Needs ATP and selenide.

Protein sequence:

MQERHTEQDYRALLIADTPIIDVRAPIEFEHGAMPAAINLPLMNNDERAAVGTCYKQQGSDAALALGHKL VAGEIRQQRMDAWRAACLQNPQGILCCARGGQRSHIVQSWLHAAGIDYPLVEGGYKALRQTAIQATIELA QKPIVLIGGCTGSGKTLLVQQQPNGVDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDARQNLR LWVLEDESRMIGSNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYGDEQGWQEYCE YLHHGLSAIKRRLGLQRYNELAARLDAALTTQLTTGSTDGHLAWLVPLLEEYYDPMYRYQLEKKAEKVVF RGEWAEVAEWVKAR

Enzymatic activities:

Reaction Substrate Type Position
cmnm5s2U:cmnm5se2U tRNA (t) Gln/UUG/prokaryotic cytosol 34
nm5s2U:nm5se2U tRNA (t) Gln/UUG/prokaryotic cytosol 34
mnm5s2U:mnm5se2U tRNA (t) Gln/UUG/prokaryotic cytosol 34
cmnm5s2U:cmnm5se2U tRNA (t)   34
nm5s2U:nm5se2U tRNA (t) Lys/SUU/prokaryotic cytosol 34
mnm5s2U:mnm5se2U tRNA (t) Lys/SUU/prokaryotic cytosol 34
cmnm5s2U:cmnm5se2U tRNA (t)   34
nm5s2U:nm5se2U tRNA (t) Glu/SUC/prokaryotic cytosol 34
mnm5s2U:mnm5se2U tRNA (t) Glu/SUC/prokaryotic cytosol 34
s2U:ges2U tRNA (t) Gln/UUG/prokaryotic cytosol 34
cmnm5s2U:cmnm5ges2U tRNA (t) Gln/UUG/prokaryotic cytosol 34
mnm5s2U:mnm5ges2U tRNA (t) Gln/UUG/prokaryotic cytosol 34
s2U:ges2U tRNA (t) Lys/SUU/prokaryotic cytosol 34
mnm5s2U:mnm5ges2U tRNA (t) Lys/SUU/prokaryotic cytosol 34
s2U:ges2U tRNA (t) Glu/SUC/prokaryotic cytosol 34
mnm5s2U:mnm5ges2U tRNA (t) Glu/SUC/prokaryotic cytosol 34

Publications:

Title Authors Journal Details PubMed Id DOI
Functional diversity of the rhodanese homology domain: the Escherichia coli ybbB gene encodes a selenophosphate-dependent tRNA 2-selenouridine synthase. Wolfe MD, Ahmed F, Lacourciere GM, Lauhon CT, Stadtman TC, Larson TJ J Biol Chem [details] 14594807 -
Discovery and biological characterization of geranylated RNA in bacteria. Dumelin CE, Chen Y, Leconte AM, Chen YG, Liu DR... Nat Chem Biol [details] 22983156 -

Links:

_EcoCyc_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto