Full name: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
Synonym: GCD10, TIF33
GI: 603585
Orf: YNL062C
COG: COG2519
UniProt: P41814
Structures: | |
Complex: Trm6/Trm61

Comments:

A 'catalytically degenerated' version of Trm61p (GDC14), required for substrate binding.

Protein sequence:

MNALTTIDFNQHVIVRLPSKNYKIVELKPNTSVSLGKFGAFEVNDIIGYPFGLTFEIYYDGEEVSSDENR DSKPKNKIPIGKVRLLSQEIKDVNNDKDDGQSEPPLSIKEKSVSLELSSIDSSATNQNLVNMGSKAQELT VEEIEKMKQESLSSKEIIDKIIKSHKSFHNKTVYSQEKYVNRKKQKFAKYFTVEYLSSSNLLQFLIDKGD IQRVLDMSQESMGMLLNLANIQSEGNYLCMDETGGLLVYFLLERMFGGDNESKSKGKVIVIHENEHANLD LLKFANYSEKFIKEHVHTISLLDFFEPPTLQEIQSRFTPLPKEEARALKGGKKNSYYRKLRWYNTQWQIL ELTGEFLYDGLVMATTLHLPTLVPKLAEKIHGSRPIVCYGQFKETLLELAHTLYSDLRFLAPSILETRCR PYQSIRGKLHPLMTMKGGGGYLMWCHRVIPAPEPVSENATAADSSEKLAEHGAKKQKI

Publications:

Title Authors Journal Details PubMed Id DOI
The Gcd10p/Gcd14p complex is the essential two-subunit tRNA(1-methyladenosine) methyltransferase of Saccharomyces cerevisiae. Anderson J, Phan L, Hinnebusch AG Proc Natl Acad Sci U S A [details] 10779558 -
Conserved amino acids in each subunit of the heteroligomeric tRNA m1A58 Mtase from Saccharomyces cerevisiae contribute to tRNA binding. Ozanick SG, Bujnicki JM, Sem DS, Anderson JT Nucleic Acids Res [details] 17932071 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto