Full name: pseudouridine synthase 10
Synonym: FLJ32312
GI: None
Orf:
COG:
UniProt:
Structures: | Q3MIT2 |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification:

Comments:



Protein sequence:

>sp|Q3MIT2|PUS10_HUMAN Putative tRNA pseudouridine synthase Pus10 OS=Homo sapiens OX=9606 GN=PUS10 PE=1 SV=1 MFPLTEENKHVAQLLLNTGTCPRCIFRFCGVDFHAPYKLPYKELLNELQKFLETEKDELI LEVMNPPPKKIRLQELEDSIDNLSQNGEGRISVSHVGSTASKNSNLNVCNVCLGILQEFC EKDFIKKVCQKVEASGFEFTSLVFSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRDDIV QLKEAYKWITHPLFSEELGVPIDGKSLFEVSVVFAHPETVEDCHFLAAICPDCFKPAKNK QSVFTRMAVMKALNKIKEEDFLKQFPCPPNSPKAVCAVLEIECAHGAVFVAGRYNKYSRN LPQTPWIIDGERKLESSVEELISDHLLAVFKAESFNFSSSGREDVDVRTLGNGRPFAIEL VNPHRVHFTSQEIKELQQKINNSSNKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWT NKAIQKKDIEFLNDIKDLKIDQKTPLRVLHRRPLAVRARVIHFMETQYVDEHHFRLHLKT QAGTYIKEFVHGDFGRTKPNIGSLMNVTADILELDVESVDVDWPPALDD

Publications:

Title Authors Journal Details PubMed Id DOI
Crystal structure of human Pus10, a novel pseudouridine synthase. McCleverty CJ, Hornsby M, Spraggon G, Kreusch A J Mol Biol [details] 17900615 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto