Full name: GON7, KEOPS complex subunit
Synonym: 14q32.12
GI: None
Orf:
COG:
UniProt:
Structures: | Q9BXV9 |
Complex:

Comments:



Protein sequence:

>sp|Q9BXV9|GON7_HUMAN EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2 MELLGEYVGQEGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRV AAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS

Publications:

Title Authors Journal Details PubMed Id DOI
Proteomic analysis of the human KEOPS complex identifies C14ORF142 as a core subunit homologous to yeast Gon7. Wan LC, Maisonneuve P, Szilard RK, Lambert JP, Ng TF, Manczyk N, Huang H, Laister R, Caudy AA, Gingras AC, Durocher D, Sicheri F... Nucleic Acids Res [details] 27903914 -
The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME. Costessi A, Mahrour N, Sharma V, Stunnenberg R, Stoel MA, Tijchon E, Conaway JW, Conaway RC, Stunnenberg HG... PLoS One [details] 22912744 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto