Full name: L antigen family member 3
Synonym: ITBA2 CVG5 DXS9951E DXS9879E ESO3 Pcc1
GI: None
Orf:
COG:
UniProt:
Structures: | Q14657 |
Complex:

Comments:



Protein sequence:

>sp|Q14657|LAGE3_HUMAN EKC/KEOPS complex subunit LAGE3 OS=Homo sapiens OX=9606 GN=LAGE3 PE=1 SV=2 MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRP HIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISV INFLDQLSLVVRTMQRFGPPVSR

Publications:

Title Authors Journal Details PubMed Id DOI
The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME. Costessi A, Mahrour N, Sharma V, Stunnenberg R, Stoel MA, Tijchon E, Conaway JW, Conaway RC, Stunnenberg HG... PLoS One [details] 22912744 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto