Full name: TP53 regulating kinase
Synonym: dJ101A2.2 prpk Nori-2p BUD32
GI: None
Orf:
COG:
UniProt:
Structures: | Q96S44 |
Complex:

Comments:



Protein sequence:

>sp|Q96S44|PRPK_HUMAN EKC/KEOPS complex subunit TP53RK OS=Homo sapiens OX=9606 GN=TP53RK PE=1 SV=2 MAAARATTPADGEEPAPEAEALAAARERSSRFLSGLELVKQGAEARVFRGRFQGRAAVIK HRFPKGYRHPALEARLGRRRTVQEARALLRCRRAGISAPVVFFVDYASNCLYMEEIEGSV TVRDYIQSTMETEKTPQGLSNLAKTIGQVLARMHDEDLIHGDLTTSNMLLKPPLEQLNIV LIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLD EVRLRGRKRSMVG

Publications:

Title Authors Journal Details PubMed Id DOI
Functional homology between yeast piD261/Bud32 and human PRPK: both phosphorylate p53 and PRPK partially complements piD261/Bud32 deficiency. Facchin S, Lopreiato R, Ruzzene M, Marin O, Sartori G, Gotz C, Montenarh M, Carignani G, Pinna LA... FEBS Lett [details] 12914926 -
Cloning and characterization of a p53-related protein kinase expressed in interleukin-2-activated cytotoxic T-cells, epithelial tumor cell lines, and the testes. Abe Y, Matsumoto S, Wei S, Nezu K, Miyoshi A, Kito K, Ueda N, Shigemoto K, Hitsumoto Y, Nikawa J, Enomoto Y... J Biol Chem [details] 11546806 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto