Full name: TP53RK binding protein
Synonym: CGI-121 CGI121
GI: None
Orf:
COG:
UniProt:
Structures: | Q9Y3C4 |
Complex:

Comments:



Protein sequence:

>sp|Q9Y3C4|TPRKB_HUMAN EKC/KEOPS complex subunit TPRKB OS=Homo sapiens OX=9606 GN=TPRKB PE=1 SV=1 MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANK AVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQE YLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of CGI-121, a novel PRPK (p53-related protein kinase)-binding protein. Miyoshi A, Kito K, Aramoto T, Abe Y, Kobayashi N, Ueda N... Biochem Biophys Res Commun [details] 12659830 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto