ID Card:

Full name: tRNA mo5U methyltransferase
Synonym: yrrM, putative acyl-CoA O-methyltransferase
UniProt: O32036
Structures: | 5ZW3 |
Enzyme type: methyltransferase
Position of modification - modification: t:34 - mo5U


PDB Structures:


5ZW3

Structure Description:

Title:
Classification:
Technique:

Abstract of the PDB Structure's related Publication:

Derivatives of 5-hydroxyuridine (ho5U), such as 5-methoxyuridine (mo5U) and 5-oxyacetyluridine (cmo5U), are ubiquitous modifications of the wobble position of bacterial tRNA that are believed to enhance translational fidelity by the ribosome. In gram-negative bacteria, the last step in the biosynthesis of cmo5U from ho5U involves the unique metabolite carboxy S-adenosylmethionine (Cx-SAM) and the carboxymethyl transferase CmoB. However, the equivalent position in the tRNA of Gram-positive bacteria is instead mo5U, where the methyl group is derived from SAM and installed by an unknown methyltransferase. By utilizing a cmoB-deficient strain of Escherichia coli as a host and assaying for the formation of mo5U in total RNA isolates with methyltransferases of unknown function from Bacillus subtilis, we found that this modification is installed by the enzyme TrmR (formerly known as YrrM). Furthermore, X-ray crystal structures of TrmR with and without the anticodon stemloop of tRNAAla have been determined, which provide insight into both sequence and structure specificity in the interactions of TrmR with tRNA.

Download RCSB-PDB Structures:

Pdb Files   5ZW3.pdb  
Pdbx/mmCIF Files   5ZW3.cif  


Protein sequence:

MTDRYEQINDYIEALLKPRPDNVKRLEAYAEEHHVPIMEKAGMEVLLQILSVKQPKKILEIGTAIGYSAIRMALELPSAEIYTIERNEKRHEEAVNNIKEFQLDDRIHVFYGDALELADAVHVTAPYDVIFIDAAKGQYQNFFHLYEPMLSPDGVIITDNVLFKGLVAEDYSKIEPKRRRRLVAKIDEYNHWLMNHPDYQTAIIPVGDGLAISKKKR

Comments:







Publications:

Title Authors Journal Details PubMed Id DOI
Identification of a novel tRNA wobble uridine modifying activity in the biosynthesis of 5-methoxyuridine. Ryu H, Grove TL, Almo SC, Kim J... Nucleic Acids Res [details] 29982645 -