Full name: heterogeneous nuclear ribonucleoprotein A2/B1
Synonym: HNRPA2B1
GI: None
Orf: None
COG: None
UniProt: P22626
Structures: | 6wpq |
Complex: None

Comments:

None

Protein sequence:

MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVARE
ESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSR
SGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNY
NDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY


Diseases connected to this enzyme:

Description Reaction Disease Name
"Expression levels of writers, readers and erasers differs between cancer cell lines; no association of the expression levels of METTL3, YTHDF1, WTAP with overall survival was found; HNRNPA2B1 over-expression is associated with poorer overall survival and promotes endocrine resistance; " A:m6A
Breast cancer

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca