Full name: NOP58 ribonucleoprotein
Synonym: NOP5,HSPC120
GI: None
Orf: None
COG: None
UniProt: Q9Y2X3
Structures: | |
Complex: None

Comments:

None

Protein sequence:

MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAFTALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKE
KLNLSCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIISD
NLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA
HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLED
RGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEP
LSEEEPCTSTAIASPEKKKKKKKKRENED


Diseases connected to this enzyme:

Description Reaction Disease Name
Hypermethylation of 4506 in 28S subunit of the ribosome leads to ribosome biogenesis deregulation xX:Xm
β-thalassemia
Hypermethylation of 4506 in 28S subunit of the ribosome leads to ribosome biogenesis deregulation xX:Xm
Hemoglobin E

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca