Full name: (2'-O-methyladenosine-N(6)-)-methyltransferase
Synonym: C20orf67, CAPAM, PPP1R121
GI: 27348125
Orf: C20orf67
COG: None
UniProt: Q9H4Z3
Structures: | 6IRV |
Complex: None
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

Cap-specific adenosine methyltransferase that catalyzes formation of N6,2'-O-dimethyladenosine cap (m6A(m)) by methylating the adenosine at the first transcribed position of capped mRNAs.

Protein sequence:

MANENHGSPREEASLLSHSPGTSNQSQPCSPKPIRLVQDLPEELVHAGWEKCWSRRENRPYYFNRFTNQSLWEMPVLGQHDVISDPLGLNATPLPQDSSL
VETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQSVPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHRGPSEVLPPHPE
VELLRSQLILKLRQHYRELCQQREGIEPPRESFNRWMLERKVVDKGSDPLLPSNCEPVVSPSMFREIMNDIPIRLSRIKFREEAKRLLFKYAEAARRLIE
SRSASPDSRKVVKWNVEDTFSWLRKDHSASKEDYMDRLEHLRRQCGPHVSAAAKDSVEGICSKIYHISLEYVKRIREKHLAILKENNISEEVEAPEVEPR
LVYCYPVRLAVSAPPMPSVEMHMENNVVCIRYKGEMVKVSRNYFSKLWLLYRYSCIDDSAFERFLPRVWCLLRRYQMMFGVGLYEGTGLQGSLPVHVFEA
LHRLFGVSFECFASPLNCYFRQYCSAFPDTDGYFGSRGPCLDFAPLSGSFEANPPFCEELMDAMVSHFERLLESSPEPLSFIVFIPEWREPPTPALTRME
QSRFKRHQLILPAFEHEYRSGSQHICKKEEMHYKAVHNTAVLFLQNDPGFAKWAPTPERLQELSAAYRQSGRSHSSGSSSSSSSEAKDRDSGREQGPSRE
PHPT

Publications:

Title Authors Journal Details PubMed Id DOI
Cap-specific terminal -methylation of RNA by an RNA polymerase II-associated methyltransferase. Shinichiro Akichika,Seiichi Hirano,Yuichi Shichino,Takeo Suzuki,Hiroshi Nishimasu,Ryuichiro Ishitani,Ai Sugita,Yutaka Hirose,Shintaro Iwasaki,Osamu Nureki,Tsutomu Suzuki Science [details] 30467178 -
Cap-specific, terminal N-methylation by a mammalian mAm methyltransferase. Hanxiao Sun,Meiling Zhang,Kai Li,Dongsheng Bai,Chengqi Yi Cell Res [details] 30487554 -
Identification of the mAm Methyltransferase PCIF1 Reveals the Location and Functions of mAm in the Transcriptome. Konstantinos Boulias,Diana Toczydłowska-Socha,Ben R Hawley,Noa Liberman,Ken Takashima,Sara Zaccara,Théo Guez,Jean-Jacques Vasseur,Françoise Debart,L Aravind,Samie R Jaffrey,Eric Lieberman Greer Mol Cell [details] 31279658 -
PCIF1 Catalyzes m6Am mRNA Methylation to Regulate Gene Expression. Erdem Sendinc,David Valle-Garcia,Abhinav Dhall,Hao Chen,Telmo Henriques,Jose Navarrete-Perea,Wanqiang Sheng,Steven P Gygi,Karen Adelman,Yang Shi Mol Cell [details] 31279659 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca