Full name: rRNA N6-adenosine-methyltransferase
Synonym: DC3, HSPC133
GI: None
Orf:
COG:
UniProt: Q9NRN9
Structures: | 6H2U | 6H2V |
Complex: TRMT112
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

Catalytic subunit of a heterodimer with TRMT112, which specifically methylates the 6th position of adenine in position 1832 of 18S rRNA

Protein sequence:

MKKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDEDALEIFNRNAEEFELT
NIDMVQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGTDMAFLKTALEMARTAVYSLHKSSTREHVQKKAAEWKIKIDIIAELRYDLPASYKFHKKKSVDI
EVDLIRFSF

Publications:

Title Authors Journal Details PubMed Id DOI
The human 18S rRNA m6A methyltransferase METTL5 is stabilized by TRMT112. Nhan van Tran,Felix G M Ernst,Ben R Hawley,Christiane Zorbas,Nathalie Ulryck,Philipp Hackert,Katherine E Bohnsack,Markus T Bohnsack,Samie R Jaffrey,Marc Graille,Denis L J Lafontaine Nucleic Acids Res [details] 31328227 -
The rRNA mA methyltransferase METTL5 is involved in pluripotency and developmental programs. Valentina V Ignatova,Paul Stolz,Steffen Kaiser,Tobias H Gustafsson,Palma Rico Lastres,Adrián Sanz-Moreno,Yi-Li Cho,Oana V Amarie,Antonio Aguilar-Pimentel,Tanja Klein-Rodewald,Julia Calzada-Wack,Lore Becker,Susan Marschall,Markus Kraiger,Lillian Garrett,Claudia Seisenberger,Sabine M Hölter,Kayla Borland,Erik Van De Logt,Pascal W T C Jansen,Marijke P Baltissen,Magdalena Valenta,Michiel Vermeulen,Wolfgang Wurst,Valerie Gailus-Durner,Helmut Fuchs,Martin Hrabe de Angelis,Oliver J Rando,Stefanie M Kellner,Sebastian Bultmann,Robert Schneider Genes Dev [details] 32217665 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca