Full name: N(6)-adenine-specific methyltransferase
Synonym:
GI: None
Orf:
COG:
UniProt: Q8N3J2
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

N6-adenine-specific RNA methyltransferase catalyzing formation of N6,2'-O-dimethyladenosine (m6A(m)) on internal positions of U2 snRNA: methylates the 6th position of adenine residues with a pre-deposited 2'-O-methylation

Protein sequence:

MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYI
TPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSE
LCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNR
YSYLSPLQIQQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNV
LPIPDHKLIVSVPCTLHSHKPPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIAVESGS

Publications:

Title Authors Journal Details PubMed Id DOI
METTL4 is an snRNA mAm methyltransferase that regulates RNA splicing. Hao Chen,Lei Gu,Esteban A Orellana,Yuanyuan Wang,Jiaojiao Guo,Qi Liu,Longfei Wang,Zhangfei Shen,Hao Wu,Richard I Gregory,Yi Xing,Yang Shi Cell Res [details] 31913360 -
N-Deoxyadenosine Methylation in Mammalian Mitochondrial DNA. Ziyang Hao,Tong Wu,Xiaolong Cui,Pingping Zhu,Caiping Tan,Xiaoyang Dou,Kai-Wen Hsu,Yueh-Te Lin,Pei-Hua Peng,Li-Sheng Zhang,Yawei Gao,Lulu Hu,Hui-Lung Sun,Allen Zhu,Jianzhao Liu,Kou-Juey Wu,Chuan He Mol Cell [details] 32183942 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca