Full name: N6-adenosine-methyltransferase non-catalytic subunit MTB
Synonym: Methyltransferase-like protein 1, Protein EMBRYO DEFECTIVE 1691, Protein METTL14 homolog
GI: None
Orf:
COG:
UniProt: Q94AI4
Structures: | |
Complex: MTA

Comments:

Probable non-catalytic subunit of the N6-methyltransferase complex, a multiprotein complex that mediates N6-methyladenosine (m6A) methylation at the 5'-[AG]GAC-3' consensus sites of some mRNAs. Associates with MTA, FIP37, VIR and HAKAI to form the m6A writer complex which is essential for adenosine methylation at specific mRNA sequences

Protein sequence:

MKKKQEESSLEKLSTWYQDGEQDGGDRSEKRRMSLKASDFESSSRSGGSKSKEDNKSVVDVEHQDRDSKRERDGRERTHGSSSDSSKRKRWDEAGGLVND
GDHKSSKLSDSRHDSGGERVSVSNEHGESRRDLKSDRSLKTSSRDEKSKSRGVKDDDRGSPLKKTSGKDGSEVVREVGRSNRSKTPDADYEKEKYSRKDE
RSRGRDDGWSDRDRDQEGLKDNWKRRHSSSGDKDQKDGDLLYDRGREREFPRQGRERSEGERSHGRLGGRKDGNRGEAVKALSSGGVSNENYDVIEIQTK
PHDYVRGESGPNFARMTESGQQPPKKPSNNEEEWAHNQEGRQRSETFGFGSYGEDSRDEAGEASSDYSGAKARNQRGSTPGRTNFVQTPNRGYQTPQGTR
GNRPLRGGKGRPAGGRENQQGAIPMPIMGSPFANLGMPPPSPIHSLTPGMSPIPGTSVTPVFMPPFAPTLIWPGARGVDGNMLPVPPVLSPLPPGPSGPR
FPSIGTPPNPNMFFTPPGSDRGGPPNFPGSNISGQMGRGMPSDKTSGGWVPPRGGGPPGKAPSRGEQNDYSQNFVDTGMRPQNFIRELELTNVEDYPKLR
ELIQKKDEIVSNSASAPMYLKGDLHEVELSPELFGTKFDVILVDPPWEEYVHRAPGVSDSMEYWTFEDIINLKIEAIADTPSFLFLWVGDGVGLEQGRQC
LKKWGFRRCEDICWVKTNKSNAAPTLRHDSRTVFQRSKEHCLMGIKGTVRRSTDGHIIHANIDTDVIIAEEPPYG

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of factors required for m(6) A mRNA methylation in Arabidopsis reveals a role for the conserved E3 ubiquitin ligase HAKAI. Růžička K, Zhang M, Campilho A, Bodi Z, Kashif M, Saleh M, Eeckhout D, El-Showk S, Li H, Zhong S, De Jaeger G, Mongan NP, Hejátko J, Helariutta Y, Fray RG New Phytol. [details] 28503769 10.1111/nph.14586

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca