Full name: Ribosomal RNA small subunit methyltransferase, mitochondrial
Synonym: 18S mitochondrial rRNA (adenine(1914)-N(6)/adenine(1915)-N(6))-dimethyltransferase, Adenosine dimethyl transferase 1B, Dimethyladenosine transferase 1B
GI: None
Orf:
COG:
UniProt: Q9FK02
Structures: | |
Complex: none
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

N6-adenine methyltransferase which modifies the AA dinucleotide at the plant mitochondrial 18S rRNA nucleotides A1914 and A1915.

Protein sequence:

MILRLKDQTLIKINSTRSYLSSLVFRRDSHSQARTKPDHDRRRRGYERDVRIEEKKEHDGLFLCKSKGQHLLTNTRILDSIVRSSDIRPTDTVLEIGPGT
GNLTMKLLEAAQNVVAVELDKRMVEILRKRVSDHGFADKLTIIQKDVLKTDFPHFDLVVANIPYNISSPLVAKLVYGSNTFRSATLLLQKEFSRRLLANP
GDSDFNRLAVNVKLVADVKFVMDVSKREFVPPPKVDSSVIRITPKEIIPDVNVQEWLAFTRTCFGKKNKTLGSMFRQKKKVMELQSLSAGRHGSNVEVMN
QTGGDSDSDVEEDGKDDLLCLDTDASMFKERVIEILRTNGFEEKRPSKLSHRELLHLLSLFNQAGIFFHDITSLQMDLHE

Publications:

Title Authors Journal Details PubMed Id DOI
A mitochondrial rRNA dimethyladenosine methyltransferase in Arabidopsis. Richter U, Kuhn K, Okada S, Brennicke A, Weihe A, Borner T Plant J [details] 19929881 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca