Full name: Ribosomal RNA small subunit methyltransferase, chloroplastic
Synonym: PALEFACE 1, Dimethyladenosine transferase 1C
GI: None
Orf: F22M8.1, T1N6.27
COG:
UniProt: O65090
Structures: | |
Complex: none
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

Required for methylation of the 3' adenosines in the small subunit of plastid rRNA. Essential for chloroplast biogenesis at low temperatures.

Protein sequence:

MMNAVITSATINCNSLSPSWTCGDNSPSKLLLGEISAALSRRRTVKVSCGKSSPDDYHSTLKSLNSRGRFPRKSLGQHYMLNSDINDQLASAADVKEGDF
VLEIGPGTGSLTNVLINLGATVLAIEKDPHMVDLVSERFAGSDKFKVLQEDFVKCHIRSHMLSILETRRLSHPDSALAKVVSNLPFNISTDVVKLLLPMG
DIFSKVVLLLQDEAALRLVEPALRTSEYRPINILINFYSEPEYNFRVPRENFFPQPKVDAAVVTFKLKHPRDYPDVSSTKNFFSLVNSAFNGKRKMLRKS
LQHISSSPDIEKALGVAGLPATSRPEELTLDDFVKLHNVIARE

Publications:

Title Authors Journal Details PubMed Id DOI
Chloroplast development at low temperatures requires a homolog of DIM1, a yeast gene encoding the 18S rRNA dimethylase. J G Tokuhisa,P Vijayan,K A Feldmann,J A Browse Plant Cell [details] 9596631 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca