ID Card:

Full name: 16S rRNA (guanine(1405)-N(7))-methyltransferase
Synonym: 16S rRNA m7G1405 methyltransferase
GI: 1035502231
UniProt: Q33DX5
Structures: | 6PQB | 6CN0 |
Complex: none
Enzyme type: methyltransferase


PDB Structures:


6PQB

Structure Description:

Title:
Classification:
Technique:

Abstract of the PDB Structure's related Publication:

Methylation of the small ribosome subunit rRNA in the ribosomal decoding center results in exceptionally high-level aminoglycoside resistance in bacteria. Enzymes that methylate 16S rRNA on N7 of nucleotide G1405 (m 7 G1405) have been identified in both aminoglycoside-producing and clinically drug-resistant pathogenic bacteria. Using a fluorescence polarization 30S-binding assay and a new crystal structure of the methyltransferase RmtC at 3.14 Å resolution, here we report a structure-guided functional study of 30S substrate recognition by the aminoglycoside resistance-associated 16S rRNA (m 7 G1405) methyltransferases. We found that the binding site for these enzymes in the 30S subunit directly overlaps with that of a second family of aminoglycoside resistance-associated 16S rRNA (m 1 A1408) methyltransferases, suggesting that both groups of enzymes may exploit the same conserved rRNA tertiary surface for docking to the 30S. Within RmtC, we defined an N-terminal domain surface, comprising basic residues from both the N1 and N2 subdomains, that directly contributes to 30S-binding affinity. In contrast, additional residues lining a contiguous adjacent surface on the C-terminal domain were critical for 16S rRNA modification but did not directly contribute to the binding affinity. The results from our experiments define the critical features of m 7 G1405 methyltransferase-substrate recognition and distinguish at least two distinct, functionally critical contributions of the tested enzyme residues: 30S-binding affinity and stabilizing a binding-induced 16S rRNA conformation necessary for G1405 modification. Our study sets the scene for future high-resolution structural studies of the 30S-methyltransferase complex and for potential exploitation of unique aspects of substrate recognition in future therapeutic strategies.

Download RCSB-PDB Structures:

Pdb Files   6CN0.pdb   6PQB.pdb  
Pdbx/mmCIF Files   6CN0.cif   6PQB.cif  


Protein sequence:

MKTNDNYIEEVTAKVLTSGKYSTLYPPTVRRVTERLFDRYPPKQLEKEVRKKLHQAYGAYIGGIDGKRLEKKIEKIIHEIPNPTTDEATRTEWEKEICLKILNLHTSTNERTVAYDELYQKIFEVTGVPTSITDAGCALNPFSFPFFTEAGMLGQYIGFDLDKGMIEAIEHSLRTLNAPEGIVVKQGDILSDPSGESDLLLMFKLYTLLDRQEEASGLKILQEWKYKNAVISFPIKTISGRDVGMEENYTVKFENDLVGSDLRIMQKLKLGNEMYFIVSRL

Comments:

Specifically methylates the N7 position of guanine 1405 in 16S rRNA. Confers resistance to various aminoglycosides, including gentamicin and kanamycin.







Publications:

Title Authors Journal Details PubMed Id DOI
RmtC introduces G1405 methylation in 16S rRNA and confers high-level aminoglycoside resistance on Gram-positive microorganisms. Jun-Ichi Wachino,Keigo Shibayama,Kouji Kimura,Kunikazu Yamane,Satowa Suzuki,Yoshichika Arakawa FEMS Microbiol Lett [details] 20722735 -
Functionally critical residues in the aminoglycoside resistance-associated methyltransferase RmtC play distinct roles in 30S substrate recognition. Meisam Nosrati,Debayan Dey,Atousa Mehrani,Sarah E Strassler,Natalia Zelinskaya,Eric D Hoffer,Scott M Stagg,Christine M Dunham,Graeme L Conn J Biol Chem [details] 31594862 -