Full name: 16S rRNA (guanine(1405)-N(7))-methyltransferase
Synonym: 16S rRNA m7G1405 methyltransferase
GI: 1035502231
Orf:
COG:
UniProt: Q33DX5
Structures: | 6PQB | 6CN0 |
Complex: none
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

Specifically methylates the N7 position of guanine 1405 in 16S rRNA. Confers resistance to various aminoglycosides, including gentamicin and kanamycin.

Protein sequence:

MKTNDNYIEEVTAKVLTSGKYSTLYPPTVRRVTERLFDRYPPKQLEKEVRKKLHQAYGAYIGGIDGKRLEKKIEKIIHEIPNPTTDEATRTEWEKEICLK
ILNLHTSTNERTVAYDELYQKIFEVTGVPTSITDAGCALNPFSFPFFTEAGMLGQYIGFDLDKGMIEAIEHSLRTLNAPEGIVVKQGDILSDPSGESDLL
LMFKLYTLLDRQEEASGLKILQEWKYKNAVISFPIKTISGRDVGMEENYTVKFENDLVGSDLRIMQKLKLGNEMYFIVSRL

Publications:

Title Authors Journal Details PubMed Id DOI
RmtC introduces G1405 methylation in 16S rRNA and confers high-level aminoglycoside resistance on Gram-positive microorganisms. Jun-Ichi Wachino,Keigo Shibayama,Kouji Kimura,Kunikazu Yamane,Satowa Suzuki,Yoshichika Arakawa FEMS Microbiol Lett [details] 20722735 -
Functionally critical residues in the aminoglycoside resistance-associated methyltransferase RmtC play distinct roles in 30S substrate recognition. Meisam Nosrati,Debayan Dey,Atousa Mehrani,Sarah E Strassler,Natalia Zelinskaya,Eric D Hoffer,Scott M Stagg,Christine M Dunham,Graeme L Conn J Biol Chem [details] 31594862 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca