Full name: rRNA adenine N-6-methyltransferase
Synonym: Erythromycin resistance protein, Macrolide-lincosamide-streptogramin B resistance protein
GI: None
Orf:
COG:
UniProt: P07287
Structures: | 6NVM |
Complex: none
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

The Erm methyltransferases confer resistance to macrolide, lincosamide and streptogramin B (MLS) antibiotics by methylation of a single adenosine base within bacterial 23 S ribosomal RNA. The ErmE methyltransferase, from the macrolide-producing bacterium Saccharopolyspora erythraea, recognizes a motif within domain V of the rRNA that specifically targets adenosine 2058 (A2058) for methylation.

Protein sequence:

MSSSDEQPRPRRRNQDRQHPNQNRPVLGRTERDRNRRQFGQNFLRDRKTIARIAETAELRPDLPVLEAGPGEGLLTRELADRARQVTSYEIDPRLAKSLR
EKLSGHPNIEVVNADFLTAEPPPEPFAFVGAIPYGITSAIVDWCLEAPTIETATMVTQLEFARKRTGDYGRWSRLTVMTWPLFEWEFVEKVDRRLFKPVP
KVDSAIMRLRRRAEPLLEGAALERYESMVELCFTGVGGNIQASLLRKYPRRRVEAALDHAGVGGGAVVAYVRPEQWLRLFERLDQKNEPRGGQPQRGRRT
GGRDHGDRRTGGQDRGDRRTGGRDHRDRQASGHGDRRSSGRNRDDGRTGEREQGDQGGRRGPSGGGRTGGRPGRRGGPGQR

Publications:

Title Authors Journal Details PubMed Id DOI
Crystal structure of ErmE - 23S rRNA methyltransferase in macrolide resistance. Alena Stsiapanava,Maria Selmer Sci Rep [details] 31601908 -
ErmE methyltransferase recognizes features of the primary and secondary structure in a motif within domain V of 23 S rRNA. I D Villsen,B Vester,S Douthwaite J Mol Biol [details] 9973557 -
Domain V of 23S rRNA contains all the structural elements necessary for recognition by the ErmE methyltransferase. B Vester,S Douthwaite J Bacteriol [details] 7961464 -
The conformation of 23S rRNA nucleotide A2058 determines its recognition by the ErmE methyltransferase. B Vester,L H Hansen,S Douthwaite RNA [details] 7489511 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca