Full name: tRNA (uracil-5-)-methyltransferase homolog A
Synonym: HpaII tiny fragments locus 9c protein
GI: None
Orf:
COG:
UniProt: Q8IZ69
Structures: | |
Complex: none
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

TRMT2A methylates U54 of cytosolic tRNAs

Protein sequence:

MSENLDNEGPKPMESCGQESSSALSCPTVSVPPAAPAALEEVEKEGAGAATGPGPQPGLYSYIRDDLFTSEIFKLELQNVPRHASFSDVRRFLGRFGLQP
HKTKLFGQPPCAFVTFRSAAERDKALRVLHGALWKGRPLSVRLARPKADPMARRRRQEGESEPPVTRVADVVTPLWTVPYAEQLERKQLECEQVLQKLAK
EIGSTNRALLPWLLEQRHKHNKACCPLEGVRPSPQQTEYRNKCEFLVGVGVDGEDNTVGCRLGKYKGGTCAVAAPFDTVHIPEATKQVVKAFQEFIRSTP
YSAYDPETYTGHWKQLTVRTSRRHQAMAIAYFHPQKLSPEELAELKTSLAQHFTAGPGRASGVTCLYFVEEGQRKTPSQEGLPLEHVAGDRCIHEDLLGL
TFRISPHAFFQVNTPAAEVLYTVIQDWAQLDAGSMVLDVCCGTGTIGLALARKVKRVIGVELCPEAVEDARVNAQDNELSNVEFHCGRAEDLVPTLVSRL
ASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGP
HSPPAQPTPGPPDNTLQETGTFPSS

Publications:

Title Authors Journal Details PubMed Id DOI
FICC-Seq: a method for enzyme-specified profiling of methyl-5-uridine in cellular RNA. Jean-Michel Carter,Warren Emmett,Igor Rdl Mozos,Annika Kotter,Mark Helm,Jernej Ule,Shobbir Hussain Nucleic Acids Res [details] 31361898 -
mU54 tRNA Hypomodification by Lack of TRMT2A Drives the Generation of tRNA-Derived Small RNAs. Marisa Pereira,Diana R Ribeiro,Miguel M Pinheiro,Margarida Ferreira,Stefanie Kellner,Ana R Soares Int J Mol Sci [details] 33799331 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca