Full name: tRNA (uracil(54)-C(5))-methyltransferase homolog
Synonym: TRM2 homolog
GI: None
Orf:
COG:
UniProt: Q96GJ1
Structures: | |
Complex: none
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

TRMT2B is responsible for both tRNA and rRNA m5U-methylation in human mitochondria. TRMT2B is not essential for viability in human cells. Knoc-out of the TRMT2B gene shows no obvious phenotype with regards to RNA stability, mitochondrial translation, or cellular growth.

Protein sequence:

MAGLKRRVPLHSLRYFISMVGLFSKPGLLPWYARNPPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLADVVTPLWRLSYEEQL
KVKFAAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQ
VAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHPQKLSQEELHVQKEIVKEFFIRGPGAACGLTSLYFQESTMTRCSHQQSPYQLLF
GEPYIFEELLSLKIRISPDAFFQINTAGAEMLYRTVGELTGVNSDTILLDICCGTGVIGLSLAQHTSRVLGIELLEQAVEDARWTAAFNGITNSEFHTGQ
AEKILPGLLKSKEDGQSIVAVVNPARAGLHYKVIQAIRNFRAIHTLVFVSCKLHGESTRNVIELCCPPDPAKKLLGEPFVLQQAVPVDLFPHTPHCELVL
LFTR

Publications:

Title Authors Journal Details PubMed Id DOI
Mouse Trmt2B protein is a dual specific mitochondrial metyltransferase responsible for mU formation in both tRNA and rRNA. Ivan Laptev,Ekaterina Shvetsova,Sergey Levitskii,Marina Serebryakova,Maria Rubtsova,Alexey Bogdanov,Piotr Kamenski,Petr Sergiev,Olga Dontsova RNA Biol [details] 31736397 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca