Full name: Probable S-adenosyl-L-methionine-dependent RNA methyltransferase RSM22, mitochondrial
Synonym:
GI: None
Orf:
COG:
UniProt: P36056
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

Monomeric variant of Rsm22 methylates mitochondrial tRNAs in vitro. Physiological RNA substrate not known yet.

Protein sequence:

MMKRCFSILPQNVRFSSKFTSLNLPKLDLADFIDSNKRGINVLPSYRDETASTTQATNSKELRLLSKTLQGQSYRDQLELNPDVSKAINNNIMAVHIPNN
LRRVATNYYKEIQEPNSLHRPCRTKMEVDAHIASIFLQNYGSIFQSLKELQKRVGPDNFKPQRILDVGYGPATGIVALNDILGPNYRPDLKDAVILGNAE
MQERAKIILSRQLNEVVDTVEENVSTEKEQETDRRNKNFQEDEHIGEVMTKKINIMTNLRSSIPASKEYDLIILTHQLLHDGNQFPIQVDENIEHYLNIL
APGGHIVIIERGNPMGFEIIARARQITLRPENFPDEFGKIPRPWSRGVTVRGKKDAELGNISSNYFLKVIAPCPHQRKCPLQVGNPNFYTHKEGKDLKFC
NFQKSIKRPKFSIELKKGKLLATSWDGSQGNASRLKGTGRRNGRDYEILNYSYLIFERSHKDENTLKEIKKLRNENVNGKYDIGSLGDDTQNSWPRIIND
PVKRKGHVMMDLCAPSGELEKWTVSRSFSKQIYHDARKSKKGDLWASAAKTQIKGLGDLNVKKFHKLEKERIKQLKKEERQKARKAMESYNELEDSLQFD
DHQFSNFEVMKKLSTFHGNDFLQHVNRK

Publications:

Title Authors Journal Details PubMed Id DOI
Expression and analysis of the SAM-dependent RNA methyltransferase Rsm22 from Saccharomyces cerevisiae. Jahangir Alam,Farah Tazkera Rahman,Shiv K Sah-Teli,Rajaram Venkatesan,M Kristian Koski,Kaija J Autio,J Kalervo Hiltunen,Alexander J Kastaniotis Acta Crystallogr D Struct Biol [details] 34076597 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca