Full name: | Chloroplast MraW-Like |
---|---|
GI: | 1063731170 |
Enzyme type: | methyltransferase |
MAGVIRAKQLFLCSSILSSNNNKVLSRLPRRSINVIAGNLNSSETKKKEKEKRKRRKEIEVEKATAEAVVNKEKRRTRSSRGYELADGDEVPSSHVPVMLGEVLDIFSSVRLRSFVDCTLGAAGHSSSIIQSHSELKNFVGMDVDPVARKLGHFHIDSLMHPTLKASIVLKNFKYIKSVIADTQPELLDVGVDGILMDLGMSSMQVNNPERGFSVLQEGPLDMRMDPQATLTAEDIVNSWPESELGRVLRDYGEESNWYLLQNRIVKARLNGGLHSTGELVDLIRGTSPASRGGRQGWIKTATRVFQGLRIAVNDELKTLQNSLYSSFDVLAPGGRLAVISFHSLEDRVVKQTFLDILGFQREEINGEGSSVKPERQIEERVEKELKEKEEWIKQTVIASKGVILTKRPITPSEEEERLNRRARSAKLRVIQKL
Chloropoplast-localized rRNA methyltransferase (Chroloplast Mraw-like) belongs to the mraw methylase protein family and is the Arabidopsis ortholog of bacterial MraW/ RsmH proteins. It is an AdoMet-Mtases, a class of enzymes that uses S-adenosyl-L-methionine (SAM or AdoMt) as a substrate for methyl transfer, thereby generating the S-adenosyl-L-homocysteine. It accounts for the N4-methylation of C1352 in chloroplast 16S rRNA, which is indispensable for the accumulation of chloroplast ribosomes. Noteworthy, loss of CMAL leads to a defect in chloroplast function. Indeed, the loss of this protein brings abnormal A.thaliana morphology, in leaf and root development. This suggests a critical role of CMAL in A.thaliana development and growth.