ID Card:
    
        
            
                | Full name:  | 
                Chloroplast MraW-Like | 
            
            
            
            
                | GI:  | 
                
                    1063731170
                    
                 | 
            
            
            
            
            
            
            
            
            
            
            
                | Enzyme type:  | 
                methyltransferase | 
            
            
            
            
            
        
      
    
  
Protein sequence:
        
        
            
                
                    MAGVIRAKQLFLCSSILSSNNNKVLSRLPRRSINVIAGNLNSSETKKKEKEKRKRRKEIEVEKATAEAVVNKEKRRTRSSRGYELADGDEVPSSHVPVMLGEVLDIFSSVRLRSFVDCTLGAAGHSSSIIQSHSELKNFVGMDVDPVARKLGHFHIDSLMHPTLKASIVLKNFKYIKSVIADTQPELLDVGVDGILMDLGMSSMQVNNPERGFSVLQEGPLDMRMDPQATLTAEDIVNSWPESELGRVLRDYGEESNWYLLQNRIVKARLNGGLHSTGELVDLIRGTSPASRGGRQGWIKTATRVFQGLRIAVNDELKTLQNSLYSSFDVLAPGGRLAVISFHSLEDRVVKQTFLDILGFQREEINGEGSSVKPERQIEERVEKELKEKEEWIKQTVIASKGVILTKRPITPSEEEERLNRRARSAKLRVIQKL
                
                
             
         
        
Comments: 
Chloropoplast-localized rRNA methyltransferase (Chroloplast Mraw-like) belongs to the mraw methylase protein family and is the Arabidopsis ortholog of bacterial MraW/ RsmH proteins. It is an AdoMet-Mtases, a class of enzymes that uses S-adenosyl-L-methionine (SAM or AdoMt) as a substrate for methyl transfer, thereby generating the S-adenosyl-L-homocysteine. It accounts for the N4-methylation of C1352 in chloroplast 16S rRNA, which is indispensable for the accumulation of chloroplast ribosomes. Noteworthy, loss of CMAL leads to a defect in chloroplast function. Indeed, the loss of this protein brings abnormal  A.thaliana  morphology, in leaf and root development. This suggests a critical role of CMAL in  A.thaliana   development and growth.
    
        
            
            
                | Reaction | 
                Substrate | 
                SubstrateType | 
                Position | 
                (Anti)Codon | 
                Modified (Anti)Codon | 
                Amino Acid Change | 
                Transcript Name | 
                Transcript Region | 
                Cellular Localization | 
                
               
                References | 
            
            
            
            
            
                | 
                    
                    
                    
                        C:m4C
                    
                 | 
                 RNA | 
                
                rRNA | 
                
                1352 | 
                  | 
                  | 
                  | 
                16S-SSU | 
                  | 
                Chloroplast | 
                
                
                    
                        32095829   
                    
                 | 
            
            
            
        
    
Publications:
    
    
        | Title | 
        Authors | 
        Journal | 
        Details | 
        PubMed Id | 
        DOI | 
    
    
    
    
    
        | The critical function of the plastid rRNA methyltransferase, CMAL, in ribosome biogenesis and plant development. | 
        Meijuan Zou,Ying Mu,Xin Chai,Min Ouyang,Long-Jiang Yu,Lixin Zhang,Jörg Meurer,Wei Chi | 
        Nucleic Acids Res | 
        
            [details]
         | 
        
            32095829
            
         | 
        
             -
            
         |