ID Card:

Full name: Chloroplast MraW-Like
GI: 1063731170
Enzyme type: methyltransferase



Protein sequence:

MAGVIRAKQLFLCSSILSSNNNKVLSRLPRRSINVIAGNLNSSETKKKEKEKRKRRKEIEVEKATAEAVVNKEKRRTRSSRGYELADGDEVPSSHVPVMLGEVLDIFSSVRLRSFVDCTLGAAGHSSSIIQSHSELKNFVGMDVDPVARKLGHFHIDSLMHPTLKASIVLKNFKYIKSVIADTQPELLDVGVDGILMDLGMSSMQVNNPERGFSVLQEGPLDMRMDPQATLTAEDIVNSWPESELGRVLRDYGEESNWYLLQNRIVKARLNGGLHSTGELVDLIRGTSPASRGGRQGWIKTATRVFQGLRIAVNDELKTLQNSLYSSFDVLAPGGRLAVISFHSLEDRVVKQTFLDILGFQREEINGEGSSVKPERQIEERVEKELKEKEEWIKQTVIASKGVILTKRPITPSEEEERLNRRARSAKLRVIQKL

Comments:

Chloropoplast-localized rRNA methyltransferase (Chroloplast Mraw-like) belongs to the mraw methylase protein family and is the Arabidopsis ortholog of bacterial MraW/ RsmH proteins. It is an AdoMet-Mtases, a class of enzymes that uses S-adenosyl-L-methionine (SAM or AdoMt) as a substrate for methyl transfer, thereby generating the S-adenosyl-L-homocysteine. It accounts for the N4-methylation of C1352 in chloroplast 16S rRNA, which is indispensable for the accumulation of chloroplast ribosomes. Noteworthy, loss of CMAL leads to a defect in chloroplast function. Indeed, the loss of this protein brings abnormal A.thaliana morphology, in leaf and root development. This suggests a critical role of CMAL in A.thaliana development and growth.




Reaction Substrate SubstrateType Position (Anti)Codon Modified (Anti)Codon Amino Acid Change Transcript Name Transcript Region Cellular Localization References
C:m4C RNA rRNA 1352 16S-SSU Chloroplast 32095829   



Publications:

Title Authors Journal Details PubMed Id DOI
The critical function of the plastid rRNA methyltransferase, CMAL, in ribosome biogenesis and plant development. Meijuan Zou,Ying Mu,Xin Chai,Min Ouyang,Long-Jiang Yu,Lixin Zhang,Jörg Meurer,Wei Chi Nucleic Acids Res [details] 32095829 -