Full name: Chloroplast MraW-Like
Synonym:
GI: 1063731170
Orf:
COG:
UniProt: not available
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

CMAL (Chloroplast MraW-Like) is the Arabidopsis ortholog of bacterial MraW/ RsmH proteins. It is responsible for N4-methylation of C1352 in chloroplast 16S rRNA.

Protein sequence:

MAGVIRAKQLFLCSSILSSNNNKVLSRLPRRSINVIAGNLNSSETKKKEKEKRKRRKEIEVEKATAEAVVNKEKRRTRSSRGYELADGDEVPSSHVPVML
GEVLDIFSSVRLRSFVDCTLGAAGHSSSIIQSHSELKNFVGMDVDPVARKLGHFHIDSLMHPTLKASIVLKNFKYIKSVIADTQPELLDVGVDGILMDLG
MSSMQVNNPERGFSVLQEGPLDMRMDPQATLTAEDIVNSWPESELGRVLRDYGEESNWYLLQNRIVKARLNGGLHSTGELVDLIRGTSPASRGGRQGWIK
TATRVFQGLRIAVNDELKTLQNSLYSSFDVLAPGGRLAVISFHSLEDRVVKQTFLDILGFQREEINGEGSSVKPERQIEERVEKELKEKEEWIKQTVIAS
KGVILTKRPITPSEEEERLNRRARSAKLRVIQKL

Publications:

Title Authors Journal Details PubMed Id DOI
The critical function of the plastid rRNA methyltransferase, CMAL, in ribosome biogenesis and plant development. Meijuan Zou,Ying Mu,Xin Chai,Min Ouyang,Long-Jiang Yu,Lixin Zhang,Jörg Meurer,Wei Chi Nucleic Acids Res [details] 32095829 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca