Full name: 12S rRNA N4-methylcytidine (m4C) methyltransferase
Synonym: METT5D1
GI: None
Orf:
COG:
UniProt: A6NJ78
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

METTL15 methyltransferase generates m4C839 in human 12S mtrRNA

Protein sequence:

MLRYPYFCRMYKECLSCWLESGIPNLGVWPNRIHTTAEKYREYEAREQTDQTQAQELHRSQDRDFETMAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSG
GHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGFSLRKDGPLDMRMDGGR
YPDMPTAADVVNALDQQALASILRTYGEEKHAKKIASAIVQARSIYPITRTQQLASIVAGAFPPSAIYTRKDLLQRSTHIATKTFQALRIFVNNELNELY
TGLKTAQKFLRPGGRLVALSFHSLEDRIVKRFLLGISMTERFNLSVRQQVMKTSQLGSDHENTEEVSMRRAPLMWELIHKKVLSPQDQDVQDNPRGRSAK
LRAAIKL

Publications:

Title Authors Journal Details PubMed Id DOI
METTL15 interacts with the assembly intermediate of murine mitochondrial small ribosomal subunit to form m4C840 12S rRNA residue. Ivan Laptev,Ekaterina Shvetsova,Sergey Levitskii,Marina Serebryakova,Maria Rubtsova,Victor Zgoda,Alexey Bogdanov,Piotr Kamenski,Petr Sergiev,Olga Dontsova Nucleic Acids Res [details] 32573735 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca