Full name: mitochondrial tRNA N(3)-methylcytidine methyltransferase, mRNA N(3)-methylcytidine methyltransferase
Synonym:
GI: None
Orf:
COG:
UniProt: Q9H825
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

S-adenosyl-L-methionine-dependent methyltransferase that mediates N3-methylcytidine modification of mRNAs and tRNA.

Protein sequence:

MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEEQVKYEREASKYWDTFYKIHKNKF
FKDRNWLLREFPEILPVDQKPEEKARESSWDHVKTSATNRFSRMHCPTVPDEKNHYEKSSGSSEGQSKTESDFSNLDSEKHKKGPMETGLFPGSNATFRI
LEVGCGAGNSVFPILNTLENSPESFLYCCDFASGAVELVKSHSSYRATQCFAFVHDVCDDGLPYPFPDGILDVILLVFVLSSIHPDRTLFI

Publications:

Title Authors Journal Details PubMed Id DOI
Three distinct 3-methylcytidine (m(3)C) methyltransferases modify tRNA and mRNA in mice and humans. Xu L, Liu X, Sheng N, Oo KS, Liang J, Chionh YH, Xu J, Ye F, Gao YG, Dedon PC, Fu XY J Biol Chem [details] 28655767 10.1074/jbc.M117.798298

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca