Full name: tRNA N(3)-methylcytidine methyltransferase
Synonym:
GI: None
Orf:
COG:
UniProt: Q6P1Q9
Structures: | |
Complex: DALRD3 (for tRNA Arg substrate)
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

METTL2B (similarly to METTL2A) mediates N3-methylcytidine modification of residue 32 of the tRNA anticodon loop of tRNA(Thr)(UGU) and tRNA(Arg)(CCU). The activity of METTL2 towards tRNA substrates is reduced to 1/10 in comparison to METTL2A. METTL2B protein carries 6 single amino acid substitutions comparing to METTL2A (V12I, R26S, P124C, L155P, I266V, M288V).

Protein sequence:

MAGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAERKVQENSIQRVCQEKQVDYEINAHKYWNDFYKIHENGFFKDRHWLFTEF
PELAPSQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICADEFPGSSATYRILEVGCGVGNTVFPILQ
TNNDPGLFVYCCDFSSTAIELVQTNSEYDPSRCFAFVHDLCDEEKSYPVPKGSLDIIILIFVLSAVVPDKMQKAINRLSRLLKPGGMVLLRDYGRYDMAQ
LRFKKGQCLSGNFYVRGDGTRVYFFTQEELDTLFTTAGLEKVQNLVDRRLQVNRGKQLTMYRVWIQCKYCKPLLSSTS

Publications:

Title Authors Journal Details PubMed Id DOI
Three distinct 3-methylcytidine (m(3)C) methyltransferases modify tRNA and mRNA in mice and humans. Xu L, Liu X, Sheng N, Oo KS, Liang J, Chionh YH, Xu J, Ye F, Gao YG, Dedon PC, Fu XY J Biol Chem [details] 28655767 10.1074/jbc.M117.798298

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca