Full name: Mitochondrial mRNA pseudouridine synthase
Synonym:
GI: None
Orf:
COG:
UniProt: Q6P087
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification:

Comments:

RPUSD3 catalyzes pseudouridylation of specific mitochondrial mRNAs. Acts at position 390 in COXI mt-mRNA and at position 697-699 in mitochondrial COXIII mt-mRNA

Protein sequence:

MRAVLAREMDGRRVLGRFWSGWRRGLGVRPVPEDAGFGTEARHQRQPRGSCQRSGPLGDQPFAGLLPKNLSREELVDALRAAVVDRKGPLVTLNKPQGLP
VTGKPGELTLFSVLPELSQSLGLREQELQVVRASGKESSGLVLLSSCPQTASRLQKYFTHARRAQRPTATYCAVTDGIPAASEGKIQAALKLEHIDGVNL
TVPVKAPSRKDILEGVKKTLSHFRVVATGSGCALVQLQPLTVFSSQLQVHMVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHL
TPSQAAQLPLHLHLHRLLLPGTRARDTPVELLAPLPPYFSRTLQCLGLRLQ

Publications:

Title Authors Journal Details PubMed Id DOI
A pseudouridine synthase module is essential for mitochondrial protein synthesis and cell viability. Antonicka H, Choquet K, Lin ZY, Gingras AC, Kleinman CL, Shoubridge EA EMBO Rep. [details] 27974379 10.15252/embr.201643391
A Genome-wide CRISPR Death Screen Identifies Genes Essential for Oxidative Phosphorylation. Jason D Arroyo,Alexis A Jourdain,Sarah E Calvo,Carmine A Ballarano,John G Doench,David E Root,Vamsi K Mootha Cell Metab [details] 27667664 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca