Full name: Pseudouridine synthase
Synonym:
GI: None
Orf:
COG:
UniProt: Q8WWH5
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification:

Comments:

TRUB1-dependent mRNA/tRNA pseudouridylation occurs in the nucleus. Characterization of TRUB1 targets demonstrates the requirement for a well-defined stem and loop structure for achieving pseudouridylation.

Protein sequence:

MAASEAAVVSSPSLKTDTSPVLETAGTVAAMAATPSARAAAAVVAAAARTGSEARVSKAALATKLLSLSGVFAVHKPKGPTSAELLNRLKEKLLAEAGMP
SPEWTKRKKQTLKIGHGGTLDSAARGVLVVGIGSGTKMLTSMLSGSKRYTAIGELGKATDTLDSTGRVTEEKPYDKITQEDIEGILQKFTGNIMQVPPLY
SALKKDGQRLSTLMKRGEVVEAKPARPVTVYSISLQKFQPPFFTLDVECGGGFYIRSLVSDIGKELSSCANVLELTRTKQGPFTLEEHALPEDKWTIDDI
AQSLEHCSSLFPAELALKKSKPESNEQVLSCEYITLNEPKREDDVIKTC

Publications:

Title Authors Journal Details PubMed Id DOI
A complete landscape of post-transcriptional modifications in mammalian mitochondrial tRNAs. Suzuki T, Suzuki T... Nucleic Acids Res [details] 24831542 -
Mammalian nuclear TRUB1, mitochondrial TRUB2, and cytoplasmic PUS10 produce conserved pseudouridine 55 in different sets of tRNA. Shaoni Mukhopadhyay,Manisha Deogharia,Ramesh Gupta RNA [details] 33023933 -
TRUB1 is the predominant pseudouridine synthase acting on mammalian mRNA via a predictable and conserved code. Modi Safra,Ronit Nir,Daneyal Farouq,Ilya Vainberg Slutskin,Schraga Schwartz Genome Res [details] 28073919 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca