Full name: Pseudouridine synthase
Synonym:
GI: None
Orf:
COG:
UniProt: O95900
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification:

Comments:

TRUB2-dependent mRNA/tRNA pseudouridylation occurs in the nucleus

Protein sequence:

MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQ
ASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRP
MNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAIRAATPQVAAELEKSLSP
GLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ

Publications:

Title Authors Journal Details PubMed Id DOI
A complete landscape of post-transcriptional modifications in mammalian mitochondrial tRNAs. Suzuki T, Suzuki T... Nucleic Acids Res [details] 24831542 -
A pseudouridine synthase module is essential for mitochondrial protein synthesis and cell viability. Antonicka H, Choquet K, Lin ZY, Gingras AC, Kleinman CL, Shoubridge EA EMBO Rep. [details] 27974379 10.15252/embr.201643391
Mammalian nuclear TRUB1, mitochondrial TRUB2, and cytoplasmic PUS10 produce conserved pseudouridine 55 in different sets of tRNA. Shaoni Mukhopadhyay,Manisha Deogharia,Ramesh Gupta RNA [details] 33023933 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca