Full name: ApaH-like phosphatase ALPH1
Synonym:
GI: None
Orf: Tb927.6.640
COG:
UniProt: Q583T9
Structures: | |
Complex:
Enzyme type: phosphatase
Position of modification - modification:

Comments:

ApaH-like phosphatase (ALPH1) as their major mRNA decapping enzyme in Trypanosoma brucei. The in vitro decapping experiments provide evidence for the decapping mechanism of ALPH1 being fundamentally different from the DCP2-mediated decapping. The data are consistent with ALPH1 leaving either a tri- or a diphosphate at the 5’ end of the decapped mRNA, instead of a monophosphate.

Protein sequence:

MTSSTLLEKLSSLKLSEGARVGGRTFRQGVMSPGTIANVTTTATTNINNTNVASAFASLMEKRQPTGSPAENEGPLRGLIIGSDGSGNNNNSSSNNNNNN
NNNNSRSMKHSSNNSSTNSGNDKPIETQAPHRSGVEGSAGKAARKLRSSPRTHQLPDEMREKTSHISAVPRSVALALASASVGVTEQPSVTVEQLMRAAP
SANVSSVTSPPRCVPTLPVEPMVVVDREGGPDAVRLATLVSGDPSNPKLIDPIDNVNAHKPIIRTVPPCDYRYIIVGDVHGCPEQLEELLLKVEFQQGKD
CLIHVGDLVNKGPDSLAVVQLVQAKGAIGVLGNHDFTLLNCIARVKGKALSQQEEVDPVMRLASTFPQGCEDYIRSLPHILRIPQYNVIVVHAGLNVENS
LEKQNVHEIMHLRRLERYTESSNNNNNNCGGKQQRNEKQRLRAVVKGSRGQPWGELWTGPECVVFGHDARAGLQELPFAYGIDTGCVYGGQLTAVVYGRD
SPKGKLVSVTGLPKDANERRGLPPPAADVYEKYAEELERLILRPTPRATPAIIGYMQKPTFLSAPPPGSPAASTGSVINNSLRPDSCCSLPAASPSLSAR
ATVRSSGVEQETLLSLLRAGEIRAVMTLMRLPAYESMWLNLLCSEVEGCTESFWIPFVKGVLDGLLNTRQNGEGDDYVEDLLQLVLEACDEFCSVREMAI
PQLRKLQQRAEGGDFALPKATVKMLKLTVSPQNA

Publications:

Title Authors Journal Details PubMed Id DOI
The ApaH-like phosphatase TbALPH1 is the major mRNA decapping enzyme of trypanosomes S Kramer PLoS Pathog [details] 28628654 10.1371/journal.ppat.1006456

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca