Full name: RNA phosphate cyclase
Synonym:
GI: None
Orf:
COG:
UniProt: P46849
Structures: | 1QHM | 1QMI | 3KGD | 3TUT | 3TUX | 3TV1 | 3TW3 |
Complex:
Enzyme type: cyclase
Position of modification - modification:

Comments:

RtcA catalyses adenylylation of 5'-p ends of DNA or RNA strands using RtcA-histidinyl-N-AMP intermediate to form A-pp-DNA and A-pp-RNA product. RtcA is coregulated in an operon with an RNA ligase, RtcB, that splices RNA 5'-OH ends to either 3'-phosphate or 2',3'-cyclic phosphate ends. RtcA might serve an end healing function in an RNA repair pathway, by converting RNA 2'-phosphates, which cannot be spliced by RtcB, to 2',3'-cyclic phosphates that can be sealed.

Protein sequence:

MKRMIALDGAQGEGGGQILRSALSLSMITGQPFTITSIRAGRAKPGLLRQHLTAVKAATEICGATVEGAELGSQRLLFRPGTVRGGDYRFAIGSAGSCTL
VLQTVLPALWFADGPSRVEVSGGTDNPSAPPADFIRRVLEPLLAKIGIHQQTTLLRHGFYPAGGGVVATEVSPVASFNTLQLGERGNIVQMRGEVLLAGV
PRHVAEREIATLAGSFSLHEQNIHNLPRDQGPGNTVSLEVESENITERFFVVGEKRVSAEVVAAQLVKEVKRYLASTAAVGEYLADQLVLPMALAGAGEF
TVAHPSCHLLTNIAVVERFLPVRFSLIETDGVTRVSIE

Publications:

Title Authors Journal Details PubMed Id DOI
Local cerebral glucose consumption during ethanol withdrawal in the rat: effects of single and multiple episodes and previous convulsive seizures. L Clemmesen,M Ingvar,R Hemmingsen,T G Bolwig Brain Res [details] 3401759 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca