Full name: Decapping nuclease RAI1
Synonym:
GI: None
Orf:
COG:
UniProt: P53063
Structures: | |
Complex:
Enzyme type: hydrolase
Position of modification - modification:

Comments:

Decapping enzyme for NAD-capped RNAs: specifically hydrolyzes the nicotinamide adenine dinucleotide (NAD) cap from a subset of RNAs by removing the entire NAD moiety from the 5'-end of an NAD-capped RNA

Protein sequence:

MGVSANLFVKQRGSTTALKQPKEIGFYSRTKDEEYLISDDTNLNYYYLPDAELDRKLDLSSGFQKFKDYYKDFEDRCSLRGLLETIESSERHKGKKINAD
IITFRGIARKLISCAFDSPSFNTVDLRIVSFNGQLFIKEVPEAVNAAKASSATEAGRNINQDLNVFTGYKFETLATLSNPLQYTPREVIEKRTKRIVSHG
DEYISVVRTGVGNCKLILGAEVDCIFDFKENGRDNLKHYAELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDHYVLKTVEEFSTEEVPV
LLKNNNPQVGSACLEAIKWYGLLTEWLLKMIPRDEDPHSQIRAFKLVFENNHLRLSEIEESDEEYSGLIDGEHILSNGFKEWRKSLK

Publications:

Title Authors Journal Details PubMed Id DOI
Extensive 5'-surveillance guards against non-canonical NAD-caps of nuclear mRNAs in yeast. Yaqing Zhang,David Kuster,Tobias Schmidt,Daniel Kirrmaier,Gabriele Nübel,David Ibberson,Vladimir Benes,Hans Hombauer,Michael Knop,Andres Jäschke Nat Commun [details] 33139726 -
"NAD-capQ" detection and quantitation of NAD caps. Ewa Grudzien-Nogalska,Jeremy G Bird,Bryce E Nickels,Megerditch Kiledjian RNA [details] 30045887 -
Identification of a quality-control mechanism for mRNA 5'-end capping. Xinfu Jiao,Song Xiang,Chanseok Oh,Charles E Martin,Liang Tong,Megerditch Kiledjian Nature [details] 20802481 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca