Full name: NAD-capped RNA hydrolase NPY1
Synonym: NPY1 YGL067W
GI: None
Orf:
COG:
UniProt: P53164
Structures: | |
Complex:
Enzyme type: hydrolase
Position of modification - modification:

Comments:

NAD-RNA decapping enzyme - hydrolyzes the pyrophosphate bond in NAD to yield nicotinamide mononucleotide (NMN) and adenosine monophosphate (AMP).

Protein sequence:

MSTAVTFFGQHVLNRVSFLRCSKEFIKKSLNHDSTVFIPFIEGEALISPENGDLVQLSNSVKSYKNILSAIVPLYTTLLNTTRSRSDESGINVTFLGLLE
GTDSAFNFEWSNISYKGTPYFGLDIRVTESTLFKKVDFEPIFSYPKVTRDHIFKQTNEDASLYSQGKMYLDWLAKYKFCPGCGSPLFPVEAGTKLQCSNE
NRNVYCNVRDARINNVCFPRTDPTVIIALTNSDYSKCCLARSKKRYGDFVLYSTIAGFMEPSETIEEACIREIWEETGISCKNIDIVRSQPWPYPCSLMI
GCLGIVQFNSKNEVINLNHDDELLDAQWFDTTEIIQALDKYAGGYRVPFKNDINLPGSTTIAFQLINHVCENYKNLRKTSSSHL

Publications:

Title Authors Journal Details PubMed Id DOI
Extensive 5'-surveillance guards against non-canonical NAD-caps of nuclear mRNAs in yeast. Yaqing Zhang,David Kuster,Tobias Schmidt,Daniel Kirrmaier,Gabriele Nübel,David Ibberson,Vladimir Benes,Hans Hombauer,Michael Knop,Andres Jäschke Nat Commun [details] 33139726 -
The NADH diphosphatase encoded by the Saccharomyces cerevisiae NPY1 nudix hydrolase gene is located in peroxisomes. S R AbdelRaheim,J L Cartwright,L Gasmi,A G McLennan Arch Biochem Biophys [details] 11361135 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca