Modomics - A Database of RNA Modifications

Full name:	Decapping and exoribonuclease protein
Synonym:	DeNADding enzyme DXO
GI:	None
Orf:
COG:
UniProt:	O77932
Structures:	\| \|
Complex:
Enzyme type:	hydrolase
Position of modification - modification:

Comments:

Decapping enzyme for NAD-capped RNAs: specifically hydrolyzes the nicotinamide adenine dinucleotide (NAD) cap from a subset of RNAs by removing the entire NAD moiety from the 5'-end of an NAD-capped RNA

Protein sequence:

MDPRGTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDRYQPRDEEVQ
ERLDHLLCWLLEHRGRLEGGPGWLAEAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPNARAQRLARPPLLRELMYMGYKFEQYMCADKP
GSSPDPSGEVNTNVAFCSVLRSRLGSHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPNVVAGFRNPDGFV
SSLKTFPTMKMFEYVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHQDAPYAFLPIWYVEAMTQDLPSPPKTPSPK

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
"NAD-capQ" detection and quantitation of NAD caps.	Ewa Grudzien-Nogalska,Jeremy G Bird,Bryce E Nickels,Megerditch Kiledjian	RNA	[details]	30045887	-
5' End Nicotinamide Adenine Dinucleotide Cap in Human Cells Promotes RNA Decay through DXO-Mediated deNADding.	Xinfu Jiao,Selom K Doamekpor,Jeremy G Bird,Bryce E Nickels,Liang Tong,Ronald P Hart,Megerditch Kiledjian	Cell	[details]	28283058	-
Structural and mechanistic basis of mammalian Nudt12 RNA deNADding.	Ewa Grudzien-Nogalska,Yixuan Wu,Xinfu Jiao,Huijuan Cui,Maria K Mateyak,Ronald P Hart,Liang Tong,Megerditch Kiledjian	Nat Chem Biol	[details]	31101919	-
2'-O-methylation of the mRNA cap protects RNAs from decapping and degradation by DXO	F Picard-Jean, C Brand, M Tremblay-Létourneau, A Allaire, M C Beaudoin, S Boudreault, C Duval, J Rainville-Sirois , F Robert, J Pelletier, B J Geiss, M Bisaillon	PLoS One	[details]	29601584	10.1371/journal.pone.0193804