Full name: Decapping and exoribonuclease protein
Synonym: DeNADding enzyme DXO
GI: None
Orf:
COG:
UniProt: O77932
Structures: | |
Complex:
Enzyme type: hydrolase
Position of modification - modification:

Comments:

Decapping enzyme for NAD-capped RNAs: specifically hydrolyzes the nicotinamide adenine dinucleotide (NAD) cap from a subset of RNAs by removing the entire NAD moiety from the 5'-end of an NAD-capped RNA

Protein sequence:

MDPRGTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDRYQPRDEEVQ
ERLDHLLCWLLEHRGRLEGGPGWLAEAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPNARAQRLARPPLLRELMYMGYKFEQYMCADKP
GSSPDPSGEVNTNVAFCSVLRSRLGSHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPNVVAGFRNPDGFV
SSLKTFPTMKMFEYVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHQDAPYAFLPIWYVEAMTQDLPSPPKTPSPK

Publications:

Title Authors Journal Details PubMed Id DOI
"NAD-capQ" detection and quantitation of NAD caps. Ewa Grudzien-Nogalska,Jeremy G Bird,Bryce E Nickels,Megerditch Kiledjian RNA [details] 30045887 -
5' End Nicotinamide Adenine Dinucleotide Cap in Human Cells Promotes RNA Decay through DXO-Mediated deNADding. Xinfu Jiao,Selom K Doamekpor,Jeremy G Bird,Bryce E Nickels,Liang Tong,Ronald P Hart,Megerditch Kiledjian Cell [details] 28283058 -
Structural and mechanistic basis of mammalian Nudt12 RNA deNADding. Ewa Grudzien-Nogalska,Yixuan Wu,Xinfu Jiao,Huijuan Cui,Maria K Mateyak,Ronald P Hart,Liang Tong,Megerditch Kiledjian Nat Chem Biol [details] 31101919 -
2'-O-methylation of the mRNA cap protects RNAs from decapping and degradation by DXO F Picard-Jean, C Brand, M Tremblay-Létourneau, A Allaire, M C Beaudoin, S Boudreault, C Duval, J Rainville-Sirois , F Robert, J Pelletier, B J Geiss, M Bisaillon PLoS One [details] 29601584 10.1371/journal.pone.0193804

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca