Full name: NAD-capped RNA hydrolase NUDT12
Synonym:
GI: None
Orf:
COG:
UniProt: Q9BQG2
Structures: | |
Complex:
Enzyme type: hydrolase
Position of modification - modification:

Comments:

mRNA decapping enzyme that specifically removes the nicotinamide adenine dinucleotide (NAD) cap from a subset of mRNAs by hydrolyzing the diphosphate linkage to produce nicotinamide mononucleotide (NMN) and 5' monophosphate mRNA

Protein sequence:

MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTALMYAARNGHPEIVQFLLEKGCDRSIVNKSRQTALDIAVFWGYKHIANLLAT
AKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDWLLAKESHPATVFILFSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIFLG
VELEIKDKLLNYAGEVPREEEDGLVAWFALGIDPIAAEEFKQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKR
LCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPGETIEDAVRREVEEESGVKVGHVQYVACQPWPMPSSLMIGC
LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQLIKHWIRINPNL

Publications:

Title Authors Journal Details PubMed Id DOI
Structural and mechanistic basis of mammalian Nudt12 RNA deNADding. Ewa Grudzien-Nogalska,Yixuan Wu,Xinfu Jiao,Huijuan Cui,Maria K Mateyak,Ronald P Hart,Liang Tong,Megerditch Kiledjian Nat Chem Biol [details] 31101919 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca