Full name: NAD-capped RNA hydrolase NUDT3
Synonym:
GI: None
Orf:
COG:
UniProt: O95989
Structures: | 2FVV | 2Q9P | 6PCK | 6PCL | 6WO7 | 6WO8 | 6WO9 | 6WOA | 6WOb | 6WOC | 6WOD | 6WOE | 6WOF | 6WOG | 6WOH | 6WOI |
Complex:
Enzyme type: hydrolase
Position of modification - modification:

Comments:

Nudt3 decapping activity normally functions to control cell migration

Protein sequence:

MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIV
TEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR


Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca